PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g015880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 706aa    MW: 79515.4 Da    PI: 6.4459
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g015880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.95.6e-1123297021373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++ L++cA+avs +d + a+ lL+r+++ +s++gd ++Rla+yf++ L+arla+ ++++y al++++ts    s+ l+a++++  v+P+ k++ 
  Csa16g015880.1 329 LRTMLVSCAQAVSINDRRTADDLLTRIRQYSSSYGDGTERLAHYFANSLEARLAGIGTQVYTALSSKKTS---ASDMLKAYQTYISVCPFKKIAT 420
                     5789**************************************************************9999...9********************* PP

            GRAS  96 ltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                     + aN+ I++ ++++  +++HiiDf+is+G+QWp+L++ La R++++ +lRiTg++ p+ g   +e + etg+rLak+++++++pfe+n+ +a+++
  Csa16g015880.1 421 IFANHSIMRLASTAnaKTIHIIDFGISYGFQWPSLIHRLAWRRGSSCKLRITGIELPQRGfrPAEGVIETGRRLAKYCQKFNIPFEYNA-IAQKW 514
                     *******99877766699****************************************99*****************************.7**** PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     ++++le+L++k+gE +aVn+ ++  +llde+v+++s+rd vLkl+++++P+v+  +    ++n++ F++rf e l +ys+lfd+ +++l r++  
  Csa16g015880.1 515 DTIKLEDLKLKEGEFVAVNSLFRFRNLLDETVAVHSPRDVVLKLIRKIKPDVFMPAILSGSYNAPFFVTRFREVLFHYSSLFDMCDTTLTRDDPM 609
                     *********************************************************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                     r++ E+e+ grei+nvvaceg+er+er e++++W++r ++aGF+++pl+++ +++ kll+++ +  +++ v+++  +l++gWk+r +++ S W
  Csa16g015880.1 610 RVMFEKEFYGREIMNVVACEGTERVERPESYKQWQARAMRAGFRQIPLDKDLVQKLKLLVENGYkTKEFDVDQDCSWLLQGWKGRIVYASSIW 702
                     *************************************************************9988999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.923303682IPR005202Transcription factor GRAS
PfamPF035141.9E-109329702IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MGSYSAGFPE SLDWFDFPGL GNGLYLNDQP LLDTGCVPPL PPEPPSYSQQ NLASADADFS  60
DSVLKYISQV LMEEDMEDKP CMFHDALSLQ AAEKSLYEAL GEKYPGDDDS SQPLITTTRP  120
APLVSSPGGS SYTSSITTTS SDSQWSFDCL ENNRPSSWLQ TPIPNNFVFQ STSKRSSPIP  180
QSVVFGSGLS NDLVSNMFND KDMALQFKKG MEEASKFLPK SSQLVIDIKN YTPALGSKEK  240
NNSVPYKMTG KKSQLREDEH SDEERSKKQA AVYVDEAELT EMFDKVLIFG EPKEPPVCIL  300
QESFQKEPAV SKSHKGEKPA ANDKETPDLR TMLVSCAQAV SINDRRTADD LLTRIRQYSS  360
SYGDGTERLA HYFANSLEAR LAGIGTQVYT ALSSKKTSAS DMLKAYQTYI SVCPFKKIAT  420
IFANHSIMRL ASTANAKTIH IIDFGISYGF QWPSLIHRLA WRRGSSCKLR ITGIELPQRG  480
FRPAEGVIET GRRLAKYCQK FNIPFEYNAI AQKWDTIKLE DLKLKEGEFV AVNSLFRFRN  540
LLDETVAVHS PRDVVLKLIR KIKPDVFMPA ILSGSYNAPF FVTRFREVLF HYSSLFDMCD  600
TTLTRDDPMR VMFEKEFYGR EIMNVVACEG TERVERPESY KQWQARAMRA GFRQIPLDKD  660
LVQKLKLLVE NGYKTKEFDV DQDCSWLLQG WKGRIVYASS IWVPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-483337028374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0053150.0AC005315.3 Arabidopsis thaliana chromosome 2 clone T9I4 map mi54, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010470002.10.0PREDICTED: scarecrow-like protein 33 isoform X1
RefseqXP_010470003.10.0PREDICTED: scarecrow-like protein 33 isoform X1
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLR0HTI10.0R0HTI1_9BRAS; Uncharacterized protein
STRINGscaffold_401365.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein